RAB43_HUMAN Q86YS6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q86YS6
Recommended name：Ras-related protein Rab-43
EC number：
Alternative names：(Ras-related protein Rab-41)
Cleaved into：
GeneID：339122
Gene names (primary )：RAB43
Gene names (synonym )：RAB41
Gene names (ORF )：
Length：212
Mass：23339
Sequence：MAGPGPGPGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC
Tissue specificity：Widely expressed in brain, testis, lung, heart, ovary, colon, kidney, uterus and spleen but not in liver. {ECO:0000269|PubMed:15018353}.
Induction：
Developmental stage：
Protein families：Small GTPase superfamily, Rab family