RHOQ_HUMAN   P17081


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P17081

Recommended name:Rho-related GTP-binding protein RhoQ

EC number:

Alternative names:(Ras-like protein TC10) (Ras-like protein family member 7A)

Cleaved into:

GeneID:23433

Gene names  (primary ):RHOQ

Gene names  (synonym ):ARHQ RASL7A TC10

Gene names  (ORF ):

Length:205

Mass:22659

Sequence:MAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLIT

Tissue specificity:

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Rho family


   💬 WhatsApp