RHES_HUMAN   Q96D21


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96D21

Recommended name:GTP-binding protein Rhes

EC number:

Alternative names:(Ras homolog enriched in striatum) (Tumor endothelial marker 2)

Cleaved into:

GeneID:23551

Gene names  (primary ):RASD2

Gene names  (synonym ):TEM2

Gene names  (ORF ):

Length:266

Mass:30366

Sequence:MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQ

Tissue specificity:Pancreatic endocrine cells (islets of Langerhans). {ECO:0000269|PubMed:11976265}.

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, RasD family


   💬 WhatsApp