SPDYC_HUMAN Q5MJ68
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5MJ68
Recommended name：Speedy protein C
EC number：
Alternative names：(Rapid inducer of G2/M progression in oocytes C) (RINGO C) (hSpy/Ringo C)
Cleaved into：
GeneID：387778
Gene names (primary )：SPDYC
Gene names (synonym )：
Gene names (ORF )：
Length：293
Mass：33166
Sequence：MLWAIPELGSPCPISISYEMSDSQDPTTSPVVTTQVELGGCSRQGGGNGFLRFRQHQEVQAFLSLLEDSFVQEFLSKDPCFQISDKYLLAMVLVYFQRAHLKLSEYTHSSLFLALYLANDMEEDLEGPKCEIFPWALGKDWCLRVGKFLHQRDKLWARMGFRAVVSRQCCEEVMAKEPFHWAWTRDRRPHHGGVQRVCPQVPVRLPRGPGLSPPHCSPCGLPQHCSSHLLKPVSSKCPSLTSECHRPPSQNYLSRVKNAWGGDFLIVLPPQMQLEPGTYSLRIFPKPPARPGH
Tissue specificity：Expressed in a variety of tissues including bone marrow, kidney, small intestine, liver, placenta and testis. {ECO:0000269|PubMed:15611625}.
Induction：
Developmental stage：
Protein families：Speedy/Ringo family