WFD12_HUMAN   Q8WWY7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8WWY7

Recommended name:WAP four-disulfide core domain protein 12

EC number:

Alternative names:(Putative protease inhibitor WAP12) (Whey acidic protein 2)

Cleaved into:

GeneID:128488

Gene names  (primary ):WFDC12

Gene names  (synonym ):C20orf122 WAP2

Gene names  (ORF ):UNQ544/PRO844

Length:111

Mass:12050

Sequence:MGSSSFLVLMVSLVLVTLVAVEGVKEGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK

Tissue specificity:Highly expressed in prostate, skin, lung and esophagus. Weakly expressed in skeletal muscle, epididymis, kidney, trachea, salivary gland, testis and seminal vesicle.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp