MIRH1_HUMAN   Q75NE6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q75NE6

Recommended name:Putative microRNA 17 host gene protein

EC number:

Alternative names:(Putative microRNA host gene 1 protein)

Cleaved into:

GeneID:

Gene names  (primary ):MIR17HG

Gene names  (synonym ):C13orf25 MIRH1 MIRHG1

Gene names  (ORF ):

Length:70

Mass:8163

Sequence:MFCHVDVKISSKRYTWTKLPLNVPKLVLIYLQSHFVLFFFSMCQSIWERPAIGRATTSSASWMVGYDCLL

Tissue specificity:Highly expressed in B-cell lymphoma and lung cancer.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp