IFT27_HUMAN   Q9BW83


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BW83

Recommended name:Intraflagellar transport protein 27 homolog

EC number:

Alternative names:(Putative GTP-binding protein RAY-like) (Rab-like protein 4)

Cleaved into:

GeneID:11020

Gene names  (primary ):IFT27

Gene names  (synonym ):RABL4 RAYL

Gene names  (ORF ):

Length:186

Mass:20480

Sequence:MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA

Tissue specificity:

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Rab family


   💬 WhatsApp