RRP7B_HUMAN   Q9NSQ0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NSQ0

Recommended name:Putative ribosomal RNA-processing protein 7 homolog B

EC number:

Alternative names:(Putative gastric cancer antigen Zg14-like protein)

Cleaved into:

GeneID:

Gene names  (primary ):RRP7BP

Gene names  (synonym ):RRP7B

Gene names  (ORF ):

Length:103

Mass:12575

Sequence:MEAYDQKIAEEEAKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLERERRKRSQKELLNYAWQHRESKMEHLAQLRKKFEEDKQRIELLRAQRKFRPY

Tissue specificity:

Induction:

Developmental stage:

Protein families:RRP7 family


   💬 WhatsApp