PURB_HUMAN   Q96QR8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96QR8

Recommended name:Transcriptional activator protein Pur-beta

EC number:

Alternative names:(Purine-rich element-binding protein B)

Cleaved into:

GeneID:5814

Gene names  (primary ):PURB

Gene names  (synonym ):

Gene names  (ORF ):

Length:312

Mass:33241

Sequence:MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSKSRLTLSMAVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTVNRGGGGFGAGPGPGGLQSGQTIALPAQGLIEFRDALAKLIDDYGGEDDELAGGPGGGAGGPGGGLYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEMKEIQERQRDKLYERRGGGSGGGEESEGEEVDED

Tissue specificity:Expressed in myocardium of heart failure patients. {ECO:0000269|PubMed:12933792}.

Induction:

Developmental stage:

Protein families:PUR DNA-binding protein family


   💬 WhatsApp