SFTPD_HUMAN P35247
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P35247
Recommended name：Pulmonary surfactant-associated protein D
EC number：
Alternative names：(PSP-D) (SP-D) (Collectin-7) (Lung surfactant protein D)
Cleaved into：
GeneID：6441
Gene names (primary )：SFTPD
Gene names (synonym )：COLEC7 PSPD SFTP4
Gene names (ORF )：
Length：375
Mass：37728
Sequence：MLLFLLSALVLLTQPLGYLEAEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
Tissue specificity：Expressed in lung, brain, pancreas and adipose tissue (mainly mature adipocytes). {ECO:0000269|PubMed:23478426}.
Induction：
Developmental stage：
Protein families：SFTPD family