PRND_HUMAN   Q9UKY0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UKY0

Recommended name:Prion-like protein doppel

EC number:

Alternative names:(PrPLP) (Prion protein 2)

Cleaved into:

GeneID:23627

Gene names  (primary ):PRND

Gene names  (synonym ):DPL

Gene names  (ORF ):UNQ1830/PRO3443

Length:176

Mass:20293

Sequence:MRKHLSWWWLATVCMLLFSHLSAVQTRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERGAGLRVTMHQPVLLCLLALIWLTVK

Tissue specificity:Expressed in testis, in Sertoli cells, ejaculated spermatozoa and in seminal fluid (at protein level). {ECO:0000269|PubMed:12200435}.

Induction:

Developmental stage:

Protein families:Prion family


   💬 WhatsApp