PBOV1_HUMAN Q9GZY1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9GZY1
Recommended name：Prostate and breast cancer overexpressed gene 1 protein
EC number：
Alternative names：(Protein UROC28) (UC28)
Cleaved into：
GeneID：59351
Gene names (primary )：PBOV1
Gene names (synonym )：UROC28
Gene names (ORF )：
Length：135
Mass：15722
Sequence：MRAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFIDYSIEQSHHAILTPLQTHLTMKGSSMKCSSLSSEAILFTLTLQLTQTLGLECCLLYLSKTIHPQII
Tissue specificity：Expressed in colon, prostate, small intestine, testis and spleen, with lower expression in thymus, ovary, and peripheral blood leukocytes. Up-regulated expression in prostate, breast, and bladder cancer, but not in lung and colon cancer. {ECO:0000269|PubMed:11156405}.
Induction：
Developmental stage：
Protein families：