TEN1L_HUMAN   Q86WV5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q86WV5

Recommended name:CST complex subunit TEN1

EC number:

Alternative names:(Protein telomeric pathways with STN1 homolog) (Telomere length regulation protein TEN1 homolog)

Cleaved into:

GeneID:100134934

Gene names  (primary ):TEN1

Gene names  (synonym ):C17orf106

Gene names  (ORF ):

Length:123

Mass:13856

Sequence:MMLPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTKLVEPFHAQVGSLYIVLGELQHQQDRGSVVKARVLTCVEGMNLPLLEQAIREQRLYKQERGGSQ

Tissue specificity:

Induction:

Developmental stage:

Protein families:TEN1 family


   💬 WhatsApp