SPRN_HUMAN   Q5BIV9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5BIV9

Recommended name:Shadow of prion protein

EC number:

Alternative names:(Protein shadoo)

Cleaved into:

GeneID:503542

Gene names  (primary ):SPRN

Gene names  (synonym ):SHO

Gene names  (ORF ):

Length:151

Mass:14522

Sequence:MNWAPATCWALLLAAAFLCDSGAAKGGRGGARGSARGGVRGGARGASRVRVRPAQRYGAPGSSLRVAAAGAAAGAAAGAAAGLAAGSGWRRAAGPGERGLEDEEDGVPGGNGTGPGIYSYRAWTSGAGPTRGPRLCLVLGGALGALGLLRP

Tissue specificity:Mainly expressed in brain. In brain, it is expressed in hippocampus. {ECO:0000269|PubMed:14527721}.

Induction:

Developmental stage:

Protein families:SPRN family


   💬 WhatsApp