PS1C1_HUMAN   Q9UIG5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UIG5

Recommended name:Psoriasis susceptibility 1 candidate gene 1 protein

EC number:

Alternative names:(Protein SEEK1)

Cleaved into:

GeneID:170679

Gene names  (primary ):PSORS1C1

Gene names  (synonym ):C6orf16 SEEK1

Gene names  (ORF ):

Length:152

Mass:16580

Sequence:MTCTDQKSHSQRALGTQTPALQGPQLLNTDPSSEETRPPHVNPDRLCHMEPANHFWHAGDLQAMISKEFHLAATQDDCRKGRTQEDILVPSSHPELFASVLPMAPEEAARLQQPQPLPPPSGIHLSASRTLAPTLLYSSPPSHSPFGLSSLI

Tissue specificity:Expressed in skin. Also found in heart, placenta, liver, skeletal muscle and pancreas. {ECO:0000269|PubMed:12930300}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp