LFG3_HUMAN   Q969X1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q969X1

Recommended name:Protein lifeguard 3

EC number:

Alternative names:(Protein RECS1 homolog) (Transmembrane BAX inhibitor motif-containing protein 1)

Cleaved into:

GeneID:64114

Gene names  (primary ):TMBIM1

Gene names  (synonym ):LFG3 RECS1

Gene names  (ORF ):PP1201 PSEC0158

Length:311

Mass:34607

Sequence:MSNPSAPPPYEDRNPLYPGPPPPGGYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPTHPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHTFIRKVYSIISVQLLITVAIIAIFTFVEPVSAFVRRNVAVYYVSYAVFVVTYLILACCQGPRRRFPWNIILLTLFTFAMGFMTGTISSMYQTKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLLVTGIVTSIVLYFQYVYWLHMLYAALGAICFTLFLAYDTQLVLGNRKHTISPEDYITGALQIYTDIIYIFTFVLQLMGDRN

Tissue specificity:

Induction:

Developmental stage:

Protein families:BI1 family, LFG subfamily


   💬 WhatsApp