TPPP2_HUMAN   P59282


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P59282

Recommended name:Tubulin polymerization-promoting protein family member 2

EC number:

Alternative names:(Protein p25-beta) (TPPP/p18)

Cleaved into:

GeneID:122664

Gene names  (primary ):TPPP2

Gene names  (synonym ):C14orf8

Gene names  (ORF ):

Length:170

Mass:18503

Sequence:MASEAEKTFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFDESGKGKGIAGREEMTDNTGYVSGYKGSGTYDKKTK

Tissue specificity:Expressed in spermatids (PubMed:23436708). Detected in liver cancer (at protein level) (PubMed:23436708). {ECO:0000269|PubMed:23436708}.

Induction:

Developmental stage:

Protein families:TPPP family


   💬 WhatsApp