TIDC1_HUMAN Q9NPL8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NPL8
Recommended name：Complex I assembly factor TIMMDC1, mitochondrial
EC number：
Alternative names：(Protein M5-14) (Translocase of inner mitochondrial membrane domain-containing protein 1) (TIMM domain containing-protein 1)
Cleaved into：
GeneID：51300
Gene names (primary )：TIMMDC1
Gene names (synonym )：C3orf1
Gene names (ORF )：UNQ247/PRO284
Length：285
Mass：32178
Sequence：MEVPPPAPRSFLCRALCLFPRVFAAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRELFGKDEQQRISKDLANICKTAATAGIIGWVYGGIPAFIHAKQQYIEQSQAEIYHNRFDAVQSAHRAATRGFIRYGWRWGWRTAVFVTIFNTVNTSLNVYRNKDALSHFVIAGAVTGSLFRINVGLRGLVAGGIIGALLGTPVGGLLMAFQKYSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDKD
Tissue specificity：Generalized expression enhanced in heart and skeletal muscle. {ECO:0000269|PubMed:11092749}.
Induction：
Developmental stage：
Protein families：Tim17/Tim22/Tim23 family