LY66D_HUMAN O95868
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O95868
Recommended name：Lymphocyte antigen 6 complex locus protein G6d
EC number：
Alternative names：(Protein Ly6-D) (Megakaryocyte-enhanced gene transcript 1 protein)
Cleaved into：
GeneID：58530
Gene names (primary )：LY6G6D
Gene names (synonym )：C6orf23 G6D MEGT1 NG25
Gene names (ORF )：
Length：133
Mass：13691
Sequence：MKPQFVGILLSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNSAVASHVAPAGILAAAATALTCLLPGLWSG
Tissue specificity：Expressed in the adult lung, and in fetal liver, lung, kidney, brain and spleen. {ECO:0000269|PubMed:12079290}.
Induction：
Developmental stage：
Protein families：