ELA_HUMAN P0DMC3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P0DMC3
Recommended name：Apelin receptor early endogenous ligand
EC number：
Alternative names：(Protein Elabela) (ELA) (Protein Toddler)
Cleaved into：
GeneID：100506013
Gene names (primary )：APELA
Gene names (synonym )：ELA TDL
Gene names (ORF )：
Length：54
Mass：6622
Sequence：MRFQQFLFAFFIFIMSLLLISGQRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP
Tissue specificity：Expressed in the intima of blood vessels (PubMed:28137936). Expressed in endothelial cells in blood vessels in the heart and lung (PubMed:28137936). Expressed in cytotrophoblasts and syncytiotrophoblasts of first-trimester placental tissue and term placentas (at protein level) (PubMed:28663440). Not detected in smooth muscle cells or cardiomyocytes (at protein level) (PubMed:28137936). Expressed in kidney (PubMed:25639753). Expressed in blood vessels (PubMed:28137936). Expressed in embryonic (ESCs) and induced (iPSCs) pluripotent stem cells (PubMed:25639753). Most highly expressed in undifferentiated embryonic stem cell and is rapidly down-regulated during differentiation (PubMed:24316148). {ECO:0000269|PubMed:24316148, ECO:0000269|PubMed:25639753, ECO:0000269|PubMed:28137936, ECO:0000269|PubMed:28663440}.
Induction：
Developmental stage：
Protein families：Elabela/Toddler family