CTGE3_HUMAN Q8IX95
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8IX95
Recommended name：Putative cTAGE family member 3
EC number：
Alternative names：(Protein cTAGE-3)
Cleaved into：
GeneID：
Gene names (primary )：CTAGE3P
Gene names (synonym )：CTAGE3
Gene names (ORF )：
Length：158
Mass：18015
Sequence：MTFKGFQMNEEKLEIGIQDASSENCQLQESQKQLLQEAEVWKEQVSELNKQKITFEDSKVHAEQVLNDKENHIETLTERLLKIKDQAAVLEEDITDDGNLELEMNSELKDGAYLDNPPKGALKKLIHAAKLNASLTTLEGERNQFIFSYLKLIKPGRA
Tissue specificity：Expressed in normal tissues including colon, mammary gland, ovary, placenta, stomach and testis, as well as several fetal tissues. {ECO:0000269|PubMed:12839582}.
Induction：
Developmental stage：
Protein families：CTAGE family