CTGE1_HUMAN Q9HC47
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9HC47
Recommended name：Cutaneous T-cell lymphoma-associated antigen 1
EC number：
Alternative names：(Protein cTAGE-1) (Cancer/testis antigen 21.1) (CT21.1)
Cleaved into：
GeneID：
Gene names (primary )：CTAGE1
Gene names (synonym )：CTAGE2
Gene names (ORF )：
Length：74
Mass：8406
Sequence：MFVIISLHNCVVISFVLFLFGGNNFIQNFYLPQNYIDQFLLTSFPTFTSVGVLIVLVLCSAFLLLWQGEGVNLR
Tissue specificity：Testis. Expressed in several cutaneous T-cell lymphoma (CTCL) cell lines, in head-neck carcinomas and carcinoma of ovarian tissues. {ECO:0000269|PubMed:11149944}.
Induction：
Developmental stage：
Protein families：