PLAC8_HUMAN   Q9NZF1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NZF1

Recommended name:Placenta-specific gene 8 protein

EC number:

Alternative names:(Protein C15)

Cleaved into:

GeneID:51316

Gene names  (primary ):PLAC8

Gene names  (synonym ):

Gene names  (ORF ):BM-004

Length:115

Mass:12507

Sequence:MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF

Tissue specificity:Expressed at high levels in plasmacytoid dendritic cells. High expression in spleen, lymph nodes, peripheral blood leukocytes, and bone marrow, with lower expression in thymus, appendix, and fetal liver.

Induction:

Developmental stage:

Protein families:Cornifelin family


   💬 WhatsApp