MUCL1_HUMAN Q96DR8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96DR8
Recommended name：Mucin-like protein 1
EC number：
Alternative names：(Protein BS106) (Small breast epithelial mucin)
Cleaved into：
GeneID：118430
Gene names (primary )：MUCL1
Gene names (synonym )：SBEM
Gene names (ORF )：UNQ590/PRO1160
Length：90
Mass：9039
Sequence：MKFLAVLVLLGVSIFLVSAQNPTTAAPADTYPATGPADDEAPDAETTAAATTATTAAPTTATTAASTTARKDIPVLPKWVGDLPNGRVCP
Tissue specificity：Expressed in mammary, salivary glands and prostate. Also detected in lung. Mainly expressed in cancer cell lines of breast origin. Highly expressed in lymph node-positive compared with node-negative tumors. Detected in all lymph node containing metastatic cells. {ECO:0000269|PubMed:12019145, ECO:0000269|PubMed:12595743, ECO:0000269|PubMed:15096563}.
Induction：
Developmental stage：
Protein families：