DYLT3_HUMAN   P51808


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P51808

Recommended name:Dynein light chain Tctex-type 3

EC number:

Alternative names:(Protein 91/23) (T-complex-associated testis-expressed 1-like)

Cleaved into:

GeneID:6990

Gene names  (primary ):DYNLT3

Gene names  (synonym ):TCTE1L TCTE1XL

Gene names  (ORF ):

Length:116

Mass:13062

Sequence:MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL

Tissue specificity:

Induction:

Developmental stage:

Protein families:Dynein light chain Tctex-type family


   💬 WhatsApp