1433B_HUMAN P31946
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P31946
Recommended name:14-3-3 protein beta/alpha
EC number:
Alternative names:(Protein 1054) (Protein kinase C inhibitor protein 1) (KCIP-1)
Cleaved into:14-3-3 protein beta/alpha, N-terminally processed
GeneID:7529
Gene names (primary ):YWHAB
Gene names (synonym ):
Gene names (ORF ):
Length:246
Mass:28082
Sequence:MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
Tissue specificity:
Induction:
Developmental stage:
Protein families:14-3-3 family