PADC1_HUMAN   Q9BSG0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BSG0

Recommended name:Protease-associated domain-containing protein 1

EC number:

Alternative names:(Protease-associated domain-containing protein of 21 kDa) (hPAP21)

Cleaved into:

GeneID:84279

Gene names  (primary ):PRADC1

Gene names  (synonym ):C2orf7 PAP21

Gene names  (ORF ):UNQ833/PRO1760

Length:188

Mass:21042

Sequence:MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFW

Tissue specificity:Highly expressed in skeletal muscle, heart and liver. Expressed at intermediate level in kidney. {ECO:0000269|PubMed:15498570}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp