PXL2B_HUMAN   Q8TBF2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8TBF2

Recommended name:Prostamide/prostaglandin F synthase

EC number:EC:1.11.1.20

Alternative names:(Prostamide/PG F synthase) (Prostamide/PGF synthase) (Peroxiredoxin-like 2B) (Protein FAM213B)

Cleaved into:

GeneID:127281

Gene names  (primary ):PRXL2B

Gene names  (synonym ):C1orf93 FAM213B

Gene names  (ORF ):

Length:198

Mass:21223

Sequence:MSTVDLARVGACILKHAVTGEAVELRSLWREHACVVAGLRRFGCVVCRWIAQDLSSLAGLLDQHGVRLVGVGPEALGLQEFLDGDYFAGELYLDESKQLYKELGFKRYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV

Tissue specificity:

Induction:

Developmental stage:

Protein families:Peroxiredoxin-like PRXL2 family, Prostamide/prostaglandin F synthase subfamily


   💬 WhatsApp