SMR3A_HUMAN   Q99954


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99954

Recommended name:Submaxillary gland androgen-regulated protein 3A

EC number:

Alternative names:(Proline-rich protein 5) (Proline-rich protein PBI)

Cleaved into:

GeneID:26952

Gene names  (primary ):SMR3A

Gene names  (synonym ):PBI PROL5

Gene names  (ORF ):

Length:134

Mass:14048

Sequence:MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPPPPCFPFGTGFVPPPHPPPYGPGRFPPPLSPPYGPGRIPPSPPPPYGPGRIQSHSLPPPYGPGYPQPPSQPRPYPPGPPFFPVNSPTDPALPTPAP

Tissue specificity:

Induction:

Developmental stage:

Protein families:PROL1/PROL3 family


   💬 WhatsApp