PNRC1_HUMAN   Q12796


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q12796

Recommended name:Proline-rich nuclear receptor coactivator 1

EC number:

Alternative names:(Proline-rich protein 2) (Protein B4-2)

Cleaved into:

GeneID:10957

Gene names  (primary ):PNRC1

Gene names  (synonym ):PROL2

Gene names  (ORF ):

Length:327

Mass:35225

Sequence:MTVVSVPQREPLVLGGRLAPLGFSSRGYFGALPMVTTAPPPLPRIPDPRALPPTLFLPHFLGGDGPCLTPQPRAPAALPNRSLAVAGGTPRAAPKKRRKKKVRASPAGQLPSRFHQYQQHRPSLEGGRSPATGPSGAQEVPGPAAALAPSPAAAAGTEGASPDLAPLRPAAPGQTPLRKEVLKSKMGKSEKIALPHGQLVHGIHLYEQPKINRQKSKYNLPLTKITSAKRNENNFWQDSVSSDRIQKQEKKPFKNTENIKNSHLKKSAFLTEVSQKENYAGAKFSDPPSPSVLPKPPSHWMGSTVENSNQNRELMAVHLKTLLKVQT

Tissue specificity:Expressed in liver, lung, fat and NK/T cells. {ECO:0000269|PubMed:11574675}.

Induction:

Developmental stage:

Protein families:PNRC family, PNRC1 subfamily


   💬 WhatsApp