PAQR4_HUMAN   Q8N4S7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8N4S7

Recommended name:Progestin and adipoQ receptor family member 4

EC number:

Alternative names:(Progestin and adipoQ receptor family member IV)

Cleaved into:

GeneID:124222

Gene names  (primary ):PAQR4

Gene names  (synonym ):

Gene names  (ORF ):

Length:273

Mass:29126

Sequence:MAFLAGPRLLDWASSPPHLQFNKFVLTGYRPASSGSGCLRSLFYLHNELGNIYTHGLALLGFLVLVPMTMPWGQLGKDGWLGGTHCVACLAPPAGSVLYHLFMCHQGGSAVYARLLALDMCGVCLVNTLGALPIIHCTLACRPWLRPAALVGYTVLSGVAGWRALTAPSTSARLRAFGWQAAARLLVFGARGVGLGSGAPGSLPCYLRMDALALLGGLVNVARLPERWGPGRFDYWGNSHQIMHLLSVGSILQLHAGVVPDLLWAAHHACPRD

Tissue specificity:Relatively widely expressed in a range of tissues. {ECO:0000269|PubMed:16044242}.

Induction:

Developmental stage:

Protein families:ADIPOR family


   💬 WhatsApp