PAQRB_HUMAN   Q15546


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q15546

Recommended name:Monocyte to macrophage differentiation factor

EC number:

Alternative names:(Progestin and adipoQ receptor family member 11) (Progestin and adipoQ receptor family member XI)

Cleaved into:

GeneID:23531

Gene names  (primary ):MMD

Gene names  (synonym ):PAQR11

Gene names  (ORF ):

Length:238

Mass:27667

Sequence:MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKITAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRELGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQELACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFMRHL

Tissue specificity:Exhibits relatively ubiquitous expression with preferential expression in mature (in vitro differentiated) macrophages. {ECO:0000269|PubMed:16044242}.

Induction:

Developmental stage:

Protein families:ADIPOR family


   💬 WhatsApp