TKN4_HUMAN Q86UU9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q86UU9
Recommended name：Tachykinin-4
EC number：
Alternative names：(Preprotachykinin-C) (PPT-C)
Cleaved into：Endokinin-A (EKA); Endokinin-A/B (EKA/B); Endokinin-C (EKC)
GeneID：255061
Gene names (primary )：TAC4
Gene names (synonym )：
Gene names (ORF )：
Length：113
Mass：12305
Sequence：MLPCLALLLLMELSVCTVAGDGGEEQTLSTEAETWVIVALEEGAGPSIQLQLQEVKTGKASQFFGLMGKRVGGRPLIQPRRKKAYQLEHTFQGLLGKRSLFTEGREDEAQGSE
Tissue specificity：Expressed at low levels in the uterus of both pregnant and non-pregnant women. Isoform 1 is found only in the adrenal gland and fetal liver. Isoform 2 is found in heart, liver, bone marrow, prostate, adrenal gland and testis. Isoform 3 and isoform 4 are expressed predominantly in adrenal gland and placenta. {ECO:0000269|PubMed:12716968, ECO:0000269|PubMed:12788812}.
Induction：
Developmental stage：
Protein families：Tachykinin family