NPB_HUMAN Q8NG41
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8NG41
Recommended name：Neuropeptide B
EC number：
Alternative names：(Preproprotein L7) (hPPL7)
Cleaved into：Neuropeptide B-23 (NPB23) (hL7); Neuropeptide B-29 (NPB29) (hL7C)
GeneID：256933
Gene names (primary )：NPB
Gene names (synonym )：PPL7 PPNPB
Gene names (ORF )：
Length：125
Mass：13097
Sequence：MARSATLAAAALALCLLLAPPGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPYARRSQPYRGAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAADCLAA
Tissue specificity：Widely expressed in the central nervous system. High levels are found in substantia nigra, hypothalamus, hyppocampus, spinal cord, placenta and fetal brain; lower levels are found in testis, uterus and ovary. Also detected at high levels in colorectal adenocarcinoma.
Induction：
Developmental stage：
Protein families：Neuropeptide B/W family