EDN1_HUMAN   P05305


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P05305

Recommended name:Endothelin-1

EC number:

Alternative names:(Preproendothelin-1) (PPET1)

Cleaved into:Endothelin-1 (ET-1); Big endothelin-1

GeneID:1906

Gene names  (primary ):EDN1

Gene names  (synonym ):

Gene names  (ORF ):

Length:212

Mass:24425

Sequence:MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGKPSRERYVTHNRAHW

Tissue specificity:Expressed in lung, placental stem villi vessels and in cultured placental vascular smooth muscle cells. {ECO:0000269|PubMed:9284755}.

Induction:

Developmental stage:

Protein families:Endothelin/sarafotoxin family


   💬 WhatsApp