PRXD1_HUMAN   A6NEY8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A6NEY8

Recommended name:Putative prolyl-tRNA synthetase associated domain-containing protein 1

EC number:

Alternative names:(PrdX deacylase domain-containing protein 1) (Prolyl-tRNA synthetase associated domain-containing protein 1 pseudogene)

Cleaved into:

GeneID:

Gene names  (primary ):PRORSD1P

Gene names  (synonym ):NCRNA00117 PRDXDD1P

Gene names  (ORF ):

Length:169

Mass:18658

Sequence:MAGAELGAALEQRLGALAIHTEVVEHPEVFTVEEMMPHIQHLKGAHSKNLFLKDKKKKNYWLVTVLHDRQINLNELAKQLGVGSGNLRFADETAMLEKLKVGQGCATPLALFCDGGDVKFVLDSAFLEGGHEKVYFHPMTNAATMGLSPEDFLTFVKMTGHDPIILNFD

Tissue specificity:

Induction:

Developmental stage:

Protein families:PRORSD1 family


   💬 WhatsApp