S66AL_HUMAN   A1A4F0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A1A4F0

Recommended name:Putative uncharacterized protein SLC66A1L

EC number:

Alternative names:(PQ-loop repeat-containing protein 2-like) (Solute carrier family 66 member 1-like)

Cleaved into:

GeneID:152078

Gene names  (primary ):SLC66A1L

Gene names  (synonym ):C3orf55 PQLC2L

Gene names  (ORF ):

Length:135

Mass:15626

Sequence:MKVVGNYRVNTANSSTDTSGEHLTCLRSQLFVAYRNGRVDEAVSLGFLDCWIGGDLTNFKGCYLTNQLPIQIFTAIFDMNTDVIILSQFMYYRLKNQKKKMIFQPQLFKDSITREKVRLSLWGVLCPVYIPYSFR

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp