PPIL1_HUMAN Q9Y3C6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Y3C6
Recommended name：Peptidyl-prolyl cis-trans isomerase-like 1
EC number：EC:5.2.1.8
Alternative names：(PPIase) (Rotamase PPIL1)
Cleaved into：
GeneID：51645
Gene names (primary )：PPIL1
Gene names (synonym )：CYPL1
Gene names (ORF )：CGI-124 UNQ2425/PRO4984
Length：166
Mass：18237
Sequence：MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG
Tissue specificity：Ubiquitous, with the most abundant expression in heart and skeletal muscle.
Induction：
Developmental stage：
Protein families：Cyclophilin-type PPIase family, PPIL1 subfamily