FKB1A_HUMAN   P62942


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P62942

Recommended name:Peptidyl-prolyl cis-trans isomerase FKBP1A

EC number:EC:5.2.1.8

Alternative names:(PPIase FKBP1A) (12 kDa FK506-binding protein) (12 kDa FKBP) (FKBP-12) (Calstabin-1) (FK506-binding protein 1A) (FKBP-1A) (Immunophilin FKBP12) (Rotamase)

Cleaved into:

GeneID:2280

Gene names  (primary ):FKBP1A

Gene names  (synonym ):FKBP1 FKBP12

Gene names  (ORF ):

Length:108

Mass:11951

Sequence:MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE

Tissue specificity:

Induction:

Developmental stage:

Protein families:FKBP-type PPIase family, FKBP1 subfamily


   💬 WhatsApp