PPIC_HUMAN P45877
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P45877
Recommended name:Peptidyl-prolyl cis-trans isomerase C
EC number:EC:5.2.1.8
Alternative names:(PPIase C) (Cyclophilin C) (Rotamase C)
Cleaved into:
GeneID:5480
Gene names (primary ):PPIC
Gene names (synonym ):CYPC
Gene names (ORF ):
Length:212
Mass:22763
Sequence:MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIADW
Tissue specificity:Expressed in kidney, skeletal muscle, pancreas, heart, lung, liver and to a lower extent in brain. {ECO:0000269|PubMed:8031755}.
Induction:
Developmental stage:
Protein families:Cyclophilin-type PPIase family