PM2PB_HUMAN   Q13670


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q13670

Recommended name:Putative postmeiotic segregation increased 2-like protein 11

EC number:

Alternative names:(PMS2-related protein 6) (Putative postmeiotic segregation increased 2 pseudogene 11)

Cleaved into:

GeneID:

Gene names  (primary ):PMS2P11

Gene names  (synonym ):PMS2L11 PMSR6

Gene names  (ORF ):

Length:270

Mass:28555

Sequence:MEKLSAASGYSDVTDSKAMGPLAVGCLTKCSHAFHLLCLLAMYCNGNKGPEHPNPGKPFTARGFPASATFQTTPGPQASRGFQNPETLADIPASPQLLTDGHYMTLPVSPDQLPCDDPMAGSGGAPVLRVGHDHGCHQQPRICNAPLPGPGPYRTEPAKAIKPIDRKSVHQICSGPVVLSLSTAVKELVENSLDAGATNIDLKLKDYGMDLIEVSGNGCGVEEENFEGLMMSPFLPATSRRRLGLDWCLITMGKSSRRPPTPTPEGPQSA

Tissue specificity:

Induction:

Developmental stage:

Protein families:DNA mismatch repair MutL/HexB family


   💬 WhatsApp