PM2P3_HUMAN Q13401
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q13401
Recommended name：Putative postmeiotic segregation increased 2-like protein 3
EC number：
Alternative names：(PMS2-related protein 3) (Postmeiotic segregation increased 2-like protein 9) (Postmeiotic segregation increased protein 5) (Putative postmeiotic segregation increased 2 pseudogene 3)
Cleaved into：
GeneID：
Gene names (primary )：PMS2P3
Gene names (synonym )：PMS2L3 PMS2L9 PMS5 PMSR3
Gene names (ORF )：
Length：168
Mass：18716
Sequence：MNTLQGPVSFKDVAVDFTQEEWRQLDPDEKIAYGDVMLENYSHLVSVGYDYHQAKHHHGVEVKEVEQGEEPWIMEGEFPCQHSPEPAKAIKPIDRKSVHQICSGPVVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLISFSSETSHM
Tissue specificity：
Induction：
Developmental stage：
Protein families：DNA mismatch repair MutL/HexB family