PMM1_HUMAN   Q92871


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q92871

Recommended name:Phosphomannomutase 1

EC number:EC:5.4.2.8

Alternative names:(PMM 1) (PMMH-22)

Cleaved into:

GeneID:5372

Gene names  (primary ):PMM1

Gene names  (synonym ):PMMH22

Gene names  (ORF ):

Length:262

Mass:29747

Sequence:MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA

Tissue specificity:Strong expression in liver, heart, brain, and pancreas; lower expression in skeletal muscle.

Induction:

Developmental stage:

Protein families:Eukaryotic PMM family


   💬 WhatsApp