RET4_HUMAN   P02753


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P02753

Recommended name:Retinol-binding protein 4

EC number:

Alternative names:(Plasma retinol-binding protein) (PRBP) (RBP)

Cleaved into:Plasma retinol-binding protein(1-182); Plasma retinol-binding protein(1-181); Plasma retinol-binding protein(1-179); Plasma retinol-binding protein(1-176)

GeneID:5950

Gene names  (primary ):RBP4

Gene names  (synonym ):

Gene names  (ORF ):PRO2222

Length:201

Mass:23010

Sequence:MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Tissue specificity:Detected in blood plasma and in urine (at protein level). {ECO:0000269|PubMed:2444024, ECO:0000269|PubMed:5541771}.

Induction:

Developmental stage:

Protein families:Calycin superfamily, Lipocalin family


   💬 WhatsApp