OOSP2_HUMAN   Q86WS3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q86WS3

Recommended name:Oocyte-secreted protein 2

EC number:

Alternative names:(Placenta-specific 1-like protein) (Protein TMEM122)

Cleaved into:

GeneID:219990

Gene names  (primary ):OOSP2

Gene names  (synonym ):PLAC1L TMEM122

Gene names  (ORF ):

Length:158

Mass:17971

Sequence:MALEVLMLLAVLIWTGAENLHVKISCSLDWLMVSVIPVAESRNLYIFADELHLGMGCPANRIHTYVYEFIYLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVWLTPVSTENEIKLDPSPFIADFQTTAEELGLLSSSPNLL

Tissue specificity:

Induction:

Developmental stage:

Protein families:PLAC1 family


   💬 WhatsApp