PIT1_HUMAN   P28069


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P28069

Recommended name:Pituitary-specific positive transcription factor 1

EC number:

Alternative names:(PIT-1) (Growth hormone factor 1) (GHF-1)

Cleaved into:

GeneID:5449

Gene names  (primary ):POU1F1

Gene names  (synonym ):GHF1 PIT1

Gene names  (ORF ):

Length:291

Mass:32912

Sequence:MSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATGLHYSVPSCHYGNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR

Tissue specificity:

Induction:

Developmental stage:

Protein families:POU transcription factor family, Class-1 subfamily


   💬 WhatsApp