PI15_HUMAN O43692
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O43692
Recommended name：Peptidase inhibitor 15
EC number：
Alternative names：(PI-15) (25 kDa trypsin inhibitor) (p25TI) (Cysteine-rich secretory protein 8) (CRISP-8) (SugarCrisp)
Cleaved into：
GeneID：51050
Gene names (primary )：PI15
Gene names (synonym )：CRISP8 P25TI
Gene names (ORF )：
Length：258
Mass：29065
Sequence：MIAISAVSSALLFSLLCEASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLCFPGVTSNYLYWFK
Tissue specificity：Weakly expressed. Expressed at low level in prostate, mammary gland, salivary gland and thyroid gland. {ECO:0000269|PubMed:11287197, ECO:0000269|PubMed:9473672}.
Induction：
Developmental stage：
Protein families：CRISP family