PHS_HUMAN   P61457


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P61457

Recommended name:Pterin-4-alpha-carbinolamine dehydratase

EC number:EC:4.2.1.96

Alternative names:(PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Dimerization cofactor of hepatocyte nuclear factor 1-alpha) (DCoH) (Dimerization cofactor of HNF1) (Phenylalanine hydroxylase-stimulating protein) (Pterin carbinolamine dehydratase) (PCD)

Cleaved into:

GeneID:5092

Gene names  (primary ):PCBD1

Gene names  (synonym ):DCOH PCBD

Gene names  (ORF ):

Length:104

Mass:12000

Sequence:MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT

Tissue specificity:

Induction:

Developmental stage:

Protein families:Pterin-4-alpha-carbinolamine dehydratase family


   💬 WhatsApp