PHS2_HUMAN   Q9H0N5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H0N5

Recommended name:Pterin-4-alpha-carbinolamine dehydratase 2

EC number:EC:4.2.1.96

Alternative names:(PHS 2) (4-alpha-hydroxy-tetrahydropterin dehydratase 2) (DcoH-like protein DCoHm) (Dimerization cofactor of hepatocyte nuclear factor 1 from muscle) (HNF-1-alpha dimerization cofactor)

Cleaved into:

GeneID:84105

Gene names  (primary ):PCBD2

Gene names  (synonym ):DCOH2 DCOHM

Gene names  (ORF ):

Length:130

Mass:14365

Sequence:MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV

Tissue specificity:

Induction:

Developmental stage:

Protein families:Pterin-4-alpha-carbinolamine dehydratase family


   💬 WhatsApp