PKHJ1_HUMAN   Q9NW61


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NW61

Recommended name:Pleckstrin homology domain-containing family J member 1

EC number:

Alternative names:(PH domain-containing family J member 1) (Guanine nucleotide-releasing protein x)

Cleaved into:

GeneID:55111

Gene names  (primary ):PLEKHJ1

Gene names  (synonym ):GNRPX

Gene names  (ORF ):

Length:149

Mass:17551

Sequence:MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEPVGALLLERCRVVREEPGTFSISFIEDPERKYHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRNEIRKVTGKDPLEQFGISEEARFQLSGLQA

Tissue specificity:Expressed in testis and liver. {ECO:0000269|PubMed:11602354}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp